PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_024477-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family CO-like
Protein Properties Length: 418aa    MW: 45762.9 Da    PI: 4.6093
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_024477-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.52e-06344439
       zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                   + C+ ++e++   +C+++  +lC +C  + H+       H++
  NNU_024477-RA  3 QLCDFCGEQRSMVYCRSDAACLCLSCDRNVHSAnalsrrHSR 44
                   57*****************************65677777766 PP

2zf-B_box24.17.5e-084689441
       zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                     C++++++ ++  C + +  lC++C  ++H +      H++++
  NNU_024477-RA 46 LLCERCNSQSAIVRCVEEKISLCQSCDWNGHGSstlgsaHKRQT 89
                   57*****************************5489999998876 PP

3CCT59.89.1e-21361404144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    R+ a++RYk K+k R+FeKkirY+sRKa+A+ R RvKGrFvk+ 
  NNU_024477-RA 361 RDSAVMRYKAKKKIRQFEKKIRYASRKARADVRRRVKGRFVKAG 404
                    899**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.3E-10147IPR000315B-box-type zinc finger
PROSITE profilePS501199.812147IPR000315B-box-type zinc finger
CDDcd000213.06E-8447No hitNo description
PROSITE profilePS501198.6464390IPR000315B-box-type zinc finger
CDDcd000210.001314790No hitNo description
SMARTSM003363.34890IPR000315B-box-type zinc finger
PROSITE profilePS5101714.882361403IPR010402CCT domain
PfamPF062031.7E-15361403IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MGQLCDFCGE QRSMVYCRSD AACLCLSCDR NVHSANALSR RHSRTLLCER CNSQSAIVRC  60
VEEKISLCQS CDWNGHGSST LGSAHKRQTI NCYSGCPSAA ELSRIWSSII DSPSIDNSNC  120
EQELGLMSID DNSISNRWGP PEDNSMIDLS GDNILNELEN MDKFGILMGS SSVPALNPIP  180
YDVDQLAGSM DSTTPKLSCP GTKDLGLGEG DDLCEDFSVS DVDLNFENYE ELFGISQNQS  240
EQLFENGGLD NLFGIKDISG ADSNYQDDFV AEGMSVGKIQ AMQPTCSNAA SADSMMSAKT  300
EPNLYYPPRQ AHSGLSISFS GMTGESSGGD YQDCGVSPAL LMGEPPWHPP CAENSFPSTS  360
RDSAVMRYKA KKKIRQFEKK IRYASRKARA DVRRRVKGRF VKAGDAYDYD PLCQTRSY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010245014.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
SwissprotQ9SSE51e-138COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A061DL860.0A0A061DL86_THECC; B-box type zinc finger protein with CCT domain isoform 1
STRINGVIT_12s0057g01350.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-116CONSTANS-like 9